PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_10842-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 76aa    MW: 8862.01 Da    PI: 7.806
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_10842-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.87e-103170445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T+ E++l  + +++ G++ W++Ia +++ gRt++++  +w 
  TRIUR3_10842-P1 31 FTEAEEDLVFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWA 70
                     9******************.*********.*******99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.8E-72775IPR001005SANT/Myb domain
SuperFamilySSF466895.23E-93072IPR009057Homeodomain-like
PROSITE profilePS500906.6553173IPR017877Myb-like domain
CDDcd001671.93E-73169No hitNo description
PfamPF002496.1E-93170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-123171IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MSSESLGKNS KIMGGRERKE VNSTAKHFVD FTEAEEDLVF RMHRLVGNRW ELIAGRIPGR  60
TAEEVEMFWA KRHQDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519331e-121JF951933.1 Aegilops speltoides clone TaMYB50 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458170.16e-34hypothetical protein SORBIDRAFT_03g028170
SwissprotB3H4X83e-20TCL2_ARATH; MYB-like transcription factor TCL2
TrEMBLA0A077RXW42e-50A0A077RXW4_WHEAT; Uncharacterized protein
TrEMBLG9DR962e-50G9DR96_AEGSP; MYB-related protein
TrEMBLM7YVH52e-50M7YVH5_TRIUA; Transcription factor TRY
STRINGMLOC_68772.12e-47(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52753157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30424.12e-21MYB_related family protein